DPCfam | MC86751
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Residues in low-complexity regions (%) | 2.9 |
| Residues in coiled-coil regions (%) | 0.99 |
| Predicted disordered residues (%) | 21.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14370 |
| Sequences matching dominant architecture (%) | 96.98 |
| Average overlap percent | 86.71 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F5CPH2 | 466-533 | 68 | KTDALRKRIEKSKLDIELTKETREYNLGTSLKSYIDPNTYVKWASHVGFDLEKFYPKTLKNKYTWALK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q84ZL5-F1 | 841-916 | 100.00 | 92.90 | View in AlphaFoldDB ↗ |