DPCfam | MC865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 1483 ± 179 aa |
| Residues in low-complexity regions (%) | 8.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.21 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF01852- PF01852 |
| Sequences matching dominant architecture (%) | 60.42 |
| Average overlap percent | 37.6 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4T8T5 | 9-1503 | 1495 | LRQTWNAALDNAQTQLQSLLTSATSPLWRRVPSAAPETAQDGSSTAQEESHVIIHKRPSKQGEIFRLILDIPVDGFSIAAWKAVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5M7Y0-F1 | 345-511 | 11.24 | 80.24 | View in AlphaFoldDB ↗ |