DPCfam | MC86337
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06068 |
| Sequences matching dominant architecture (%) | 97.78 |
| Average overlap percent | 22.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1WIW6 | 209-269 | 61 | AYATEFDLEAEEYVPIPKGEVHKKKEIVQDVTLHDLDIANARPQGGQDIMSMMGQLMKPKM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P60122-F1 | 209-272 | 100.00 | 78.26 | View in AlphaFoldDB ↗ |