DPCfam | MC86200
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 206 ± 40 aa |
| Residues in low-complexity regions (%) | 9.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.66 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14369- PF13639 |
| Sequences matching dominant architecture (%) | 51.95 |
| Average overlap percent | 88.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K9P736 | 14-218 | 205 | SSALQQYFCHQCNRTVNITPSPNSDVFCPICNGGFVEEFTLSSLFFTPRPTPPTTLDVQQPADIFRFLGFDGLPDRTRNLSSSGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1A601-F1 | 10-260 | 100.00 | 62.51 | View in AlphaFoldDB ↗ |