DPCfam | MC8608
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Residues in low-complexity regions (%) | 5.87 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 11.7 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009478A02 | 736-873 | 138 | DSAYGLFVRCIHLVCQRLMSAWKTDLNVSLAALELLSGLAKVKIDIQDVLECKRAVKWICDYIGYQCSRPPPNHSRDLHSMIVAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X2JEC6-F1 | 987-1131 | 99.26 | 89.58 | View in AlphaFoldDB ↗ |