DPCfam | MC8578
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03237 |
| Sequences matching dominant architecture (%) | 26.42 |
| Average overlap percent | 19.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4RD14 | 45-104 | 60 | VFLGYQQKWFLDESGVVIGQKSRRTGITWAEAGRNVINAAKPKKRGGRNTFYVGSKQEMA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44224-F1 | 14-79 | 97.06 | 94.06 | View in AlphaFoldDB ↗ |