DPCfam | MC8545
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.49 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | PF03074 |
| Sequences matching dominant architecture (%) | 94.71 |
| Average overlap percent | 45.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L0CZQ4 | 201-407 | 207 | FLGSSKPGHVYMDSMGFGMASNIAQARYLYDSLVSLTPVMLAVSAAAPVFKGFLVDQDVRWNVISGAVDDRTFIERDVEPYEGTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P48506-F1 | 224-365 | 97.95 | 97.58 | View in AlphaFoldDB ↗ |