DPCfam | MC85341
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 216 ± 29 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.5 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094841FC | 853-1055 | 203 | KEDDADELHELFHRRNMLAVFCKLVVYNVLDLSAAAEIYQFYLKHYHHFGDIIKETMTRTRQNDRLRNALSLLLCLQQLFQKHMD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35638-F1 | 816-1049 | 100.00 | 88.81 | View in AlphaFoldDB ↗ |