DPCfam | MC85280
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Residues in low-complexity regions (%) | 2.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01368 |
| Sequences matching dominant architecture (%) | 91.18 |
| Average overlap percent | 32.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003608597 | 215-417 | 203 | LKGFSKKYTRDIYLVMLGRGQLEKAMREKFDVLDRVRELHAGNRIPVTLSIGVATGEPSLAALGERAQIGLDVALGRGGDQVAAY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GCG4-F1 | 220-429 | 99.52 | 91.22 | View in AlphaFoldDB ↗ |