DPCfam | MC85040
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1711 |
|---|---|
| Mean domain length (aa) | 304 ± 24 aa |
| Residues in low-complexity regions (%) | 8.39 |
| Residues in coiled-coil regions (%) | 0.34 |
| Predicted disordered residues (%) | 0.48 |
| Average transmembrane regions | 7.92 |
| Dominant Pfam architecture(s) | PF14897 |
| Sequences matching dominant architecture (%) | 99.82 |
| Average overlap percent | 92.03 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8RS86 | 36-315 | 280 | MFVISALRGDFTADHSNYLFGFIANSKKTLADIIFGIQTHSSFQKGFDIFEWMISRITDDPQMLIVVTSFIILYAYYRIGKNLND... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P71056-F1 | 39-346 | 98.94 | 93.42 | View in AlphaFoldDB ↗ |