DPCfam | MC84703
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00135 |
| Sequences matching dominant architecture (%) | 9.84 |
| Average overlap percent | 1.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7SPT7 | 3-168 | 166 | LLTSLIGLAIGHLAAPLVCGFAIPSSSSLKSDIILLYNNDLNLSQQPTQRSALLLSTPQIHAHASSACAALGEKLLPVNKTFLTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q2D2-F1 | 29-188 | 94.70 | 81.83 | View in AlphaFoldDB ↗ |