DPCfam | MC84413
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 199 ± 29 aa |
| Residues in low-complexity regions (%) | 0.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.49 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06650 |
| Sequences matching dominant architecture (%) | 2.2 |
| Average overlap percent | 20.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J9K7I7 | 1992-2174 | 183 | LPLIKADKRYFNIKHKLSSVNEPWGLVTDTQVINGSMVVTLRSVVQIHNHFNESIFLYYKKQGKLKMIGKAKPNKPFNLPVHSIY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DV03-F1 | 863-1057 | 97.57 | 83.32 | View in AlphaFoldDB ↗ |