DPCfam | MC84310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2261 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Residues in low-complexity regions (%) | 7.76 |
| Residues in coiled-coil regions (%) | 59.56 |
| Predicted disordered residues (%) | 23.63 |
| Average transmembrane regions | 0.54 |
| Dominant Pfam architecture(s) | PF05739 |
| Sequences matching dominant architecture (%) | 42.11 |
| Average overlap percent | 49.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J4GJY9 | 863-940 | 78 | RSAYREVQERHEDIKRIEKTITELAQLFNDMSVMVEQQDEQINVIETTAGTVEKDTELGLQYTEKAVVSARAARKKRW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5R4L2-F1 | 190-276 | 97.59 | 81.76 | View in AlphaFoldDB ↗ |