DPCfam | MC84044
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Residues in low-complexity regions (%) | 1.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.64 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009525E7F | 59-214 | 156 | DKYITFICAPCDDESTDKSKEIYLKLTSELNRKNIDFVVGGGKEFIETDGPYPHLNESNMLQHEKCNAIIVIADDHSTFSQLSLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FDH7-F1 | 26-157 | 98.45 | 91.58 | View in AlphaFoldDB ↗ |