DPCfam | MC83993
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 281 ± 39 aa |
| Residues in low-complexity regions (%) | 2.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11974 |
| Sequences matching dominant architecture (%) | 59.36 |
| Average overlap percent | 24.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B37DD19 | 265-540 | 276 | DLAKAASFIEISPKKDFTVEPYGGGFALASKGFGPQDRVKVTIKKGFPALSGRALAAEWSRAFIFPDVEPSVRFPEPGSVISPED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GRN4-F1 | 84-361 | 99.63 | 83.68 | View in AlphaFoldDB ↗ |