DPCfam | MC83926
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 334 ± 44 aa |
| Residues in low-complexity regions (%) | 3.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.24 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF07727 |
| Sequences matching dominant architecture (%) | 0.55 |
| Average overlap percent | 0.25 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9CK55 | 1672-2045 | 374 | VQRFELVLAHSYSASVLGRGFQGDDLAQRLLKVRLALGGKAPRTLQKRFGQAAKLVSWADSQSIKAFPIDRQIAEEYLRSLLDSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O50655-F1 | 42-323 | 83.06 | 92.86 | View in AlphaFoldDB ↗ |