DPCfam | MC83877
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 129 ± 27 aa |
| Residues in low-complexity regions (%) | 10.21 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 18.65 |
| Average transmembrane regions | 0.59 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136Q7R0 | 293-391 | 99 | SLVATVGAMIAQSSTAMIGTAYLAADRDINEAQDYYTQKEAELLQEAYSLEGQNPGYDEYRYNIGEVEHNPYELMAFLTAAHKDF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IKT8-F1 | 288-333 | 35.66 | 48.49 | View in AlphaFoldDB ↗ |