DPCfam | MC83847
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 361 ± 37 aa |
| Residues in low-complexity regions (%) | 9.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.15 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF17748- PF17747 |
| Sequences matching dominant architecture (%) | 95.65 |
| Average overlap percent | 89.31 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W6MUB6 | 10-358 | 349 | SSPKDELVVIPSGQLYLVRSPTSPKGESECLYNDVVASIRETSIQYNYQLIIQKAFEEGEVSDREEDNDESSVFDDLEEGKDDDW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CH96-F1 | 18-371 | 99.15 | 77.23 | View in AlphaFoldDB ↗ |