DPCfam | MC83724
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11867 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C0QY63 | 784-910 | 127 | ETALYESVKVIINKIENHQKLSIKDINQRINKILENSIQSEGIMNIFEGNEDSKEFSLFDKKYLKSIANMKYKNIALEVLNKLLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O05052-F1 | 814-930 | 99.16 | 67.28 | View in AlphaFoldDB ↗ |