DPCfam | MC8366
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Residues in low-complexity regions (%) | 14.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.02 |
| Average transmembrane regions | 0.93 |
| Dominant Pfam architecture(s) | PF11014 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D0NND1 | 67-162 | 96 | SFALRALSMVFFAAFAVIATIMGFVHAPPLGFALAALFLWRGFGRFGAGAAAEQVAPRTPEAALRPTGNEAFDAYRTDMLQRLRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KTT9-F1 | 670-731 | 51.75 | 87.34 | View in AlphaFoldDB ↗ |