DPCfam | MC83640
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Residues in low-complexity regions (%) | 11.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 50.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5Z9Z3 | 294-379 | 86 | SNARQRNLKQKFVALLKRFKITEDLQGLENEADEDPTKLTGADLEMDAGDIEDLIDELEDLSDSGPEMDTLSVTSTPKPSLRPFF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3V3Q7-F1 | 201-295 | 93.94 | 45.99 | View in AlphaFoldDB ↗ |