DPCfam | MC83477
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 5391 |
|---|---|
| Mean domain length (aa) | 173 ± 26 aa |
| Residues in low-complexity regions (%) | 2.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.26 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00588 |
| Sequences matching dominant architecture (%) | 67.56 |
| Average overlap percent | 85.42 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151Z5H6 | 43-226 | 184 | FKEVSLKRSNRFVIVCDNLRSGGNISAIIRSCDAMGIQNLSIIDEYDKDIDEDATYEPNGLTAVSKGSHRWLDIKRFKNTLECVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F8F7-F1 | 116-254 | 94.17 | 94.38 | View in AlphaFoldDB ↗ |