DPCfam | MC83419
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Residues in low-complexity regions (%) | 8.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 65.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093BVJ7 | 5-61 | 57 | FMSLKTTSVAAVKGERQKEKILERQKAQEIEQAMLSERELNPYWKDGGTGLPPEKDE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3LSS0-F1 | 113-210 | 100.00 | 55.95 | View in AlphaFoldDB ↗ |