DPCfam | MC83196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 231 ± 18 aa |
| Residues in low-complexity regions (%) | 3.67 |
| Residues in coiled-coil regions (%) | 16.71 |
| Predicted disordered residues (%) | 24.54 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF13675- PF13675 |
| Sequences matching dominant architecture (%) | 47.6 |
| Average overlap percent | 87.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R1I7N0 | 22-268 | 247 | AAIAQGTPPDASRIAQDIAAAGSLRTQSQRLAKLHLQGAMGIDAVRARRDVQSGSDSVDALFGRLAGYAQKPETRRAYLRCATVW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HZJ1-F1 | 30-262 | 96.97 | 91.57 | View in AlphaFoldDB ↗ |