DPCfam | MC82196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 672 ± 51 aa |
| Residues in low-complexity regions (%) | 3.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.07 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 45.35 |
| Average overlap percent | 8.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146HZD2 | 449-1124 | 676 | LPDEILSQILSPALTVPDRDFASTASVSPFATYSESASAYLLVCKAWLRVATPLLYHVVVVRSKAQAATLARALLQKDLNLGRFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PDI0-F1 | 133-434 | 45.37 | 93.44 | View in AlphaFoldDB ↗ |