DPCfam | MC82127
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 225 ± 22 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 0.67 |
| Predicted disordered residues (%) | 5.05 |
| Average transmembrane regions | 4.88 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H6C220 | 8-257 | 250 | DGLGNTYIGIVIAWTCLLLPAAIFLIRHRKLPYLRMRNIPLAISAVATLHVYWVLCMIAYVLNGYFPCATEYWIMSIYLPLGIAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GD90-F1 | 20-249 | 100.00 | 83.94 | View in AlphaFoldDB ↗ |