DPCfam | MC82116
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3361 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Residues in low-complexity regions (%) | 2.54 |
| Residues in coiled-coil regions (%) | 6.28 |
| Predicted disordered residues (%) | 27.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13884 |
| Sequences matching dominant architecture (%) | 78.08 |
| Average overlap percent | 47.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H5BCP6 | 351-494 | 144 | ASHRWSQVWAANGTIQTSDRRDKTDITDTALGLDFVMSLRPVSYRWAVGGFDVIADPAAVADAAGDRPTIAVAVPGRRTHYGLIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0EH66-F1 | 565-673 | 89.04 | 89.32 | View in AlphaFoldDB ↗ |