DPCfam | MC82049
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 332 ± 34 aa |
| Residues in low-complexity regions (%) | 7.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.29 |
| Average transmembrane regions | 0.96 |
| Dominant Pfam architecture(s) | PF12773 |
| Sequences matching dominant architecture (%) | 9.52 |
| Average overlap percent | 14.58 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A017T071 | 14-329 | 316 | FWDCKYCGQKKLLGLTHRFCANCGAPQDATARYFPSDAEKVAVQDHQYVGADLRCPACSAWNSRNVNCCTQCGGPMAAGKVAQVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DWC2-F1 | 320-408 | 25.07 | 67.37 | View in AlphaFoldDB ↗ |