DPCfam | MC81793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 54 ± 7 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 28.09 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W9AQP7 | 292-352 | 61 | SEYLFERSTGYMGSLISLITRGCARAVRTGEEALTEGLLDQVRIDVAAEAERKQTAKLLRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D1C2C6-F1 | 357-392 | 65.38 | 92.99 | View in AlphaFoldDB ↗ |