DPCfam | MC81714
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 532 ± 58 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.73 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF06527 |
| Sequences matching dominant architecture (%) | 79.11 |
| Average overlap percent | 21.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B1A8T8 | 15-575 | 561 | ETLPSFFARLAAANGTDAISFAMDMGGSLKRVIHQDAEMVKLVGQLAGITDEEMTTLLSWTGEPLGDVRMQYRGEVFVSRAVRNP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ETU8-F1 | 10-169 | 30.60 | 91.40 | View in AlphaFoldDB ↗ |