DPCfam | MC81683
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 751 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Residues in low-complexity regions (%) | 16.58 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 22.27 |
| Average transmembrane regions | 0.61 |
| Dominant Pfam architecture(s) | PF18933 |
| Sequences matching dominant architecture (%) | 13.08 |
| Average overlap percent | 40.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2LER5 | 4-72 | 69 | ILFIIALIAVVAGFYFFFVVPNRTIELSPANKISTPATAINEATYRSSGFGFSFRYPSDWVVKETAEGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2R8Q6-F1 | 50-100 | 58.02 | 58.45 | View in AlphaFoldDB ↗ |