DPCfam | MC81565
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 562 ± 21 aa |
| Residues in low-complexity regions (%) | 3.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13604 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 9.86 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7Z503 | 111-672 | 562 | PSFSAAAVPYLWMLKGNAEEKNELFDLGFNKDMEPELDWQKGKQDTSDNWIQESGNQKAMLNCFFEHLDPASSLILFYAKQVPFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58914-F1 | 114-619 | 88.97 | 87.29 | View in AlphaFoldDB ↗ |