DPCfam | MC81516
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 408 ± 86 aa |
| Residues in low-complexity regions (%) | 8.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.42 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13365 |
| Sequences matching dominant architecture (%) | 54.17 |
| Average overlap percent | 39.02 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000369A137 | 7-471 | 465 | VAVRATCDGRPTRISSGYVIAPRLILTAAHAVPPDARAEVQPLQAPGLLPCMSVWDGRGRGLDAALLEVPAQHWPSRLGDSPVRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EU09-F1 | 19-415 | 97.42 | 81.18 | View in AlphaFoldDB ↗ |