DPCfam | MC81269
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 206 ± 26 aa |
| Residues in low-complexity regions (%) | 15.02 |
| Residues in coiled-coil regions (%) | 0.17 |
| Predicted disordered residues (%) | 1.54 |
| Average transmembrane regions | 5.56 |
| Dominant Pfam architecture(s) | PF00115 |
| Sequences matching dominant architecture (%) | 1.49 |
| Average overlap percent | 16.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000996A6B9 | 189-425 | 236 | LHLWAGLIGWFLFLIAGYSFKMLPMFFLAHGHDEKWQKWILIALHGAIWVSAAAGAAGMASVFLPFSLALLSLGLVMLLVQISEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O67062-F1 | 179-362 | 98.04 | 96.51 | View in AlphaFoldDB ↗ |