DPCfam | MC81068
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 891 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Residues in low-complexity regions (%) | 0.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11638 |
| Sequences matching dominant architecture (%) | 95.87 |
| Average overlap percent | 81.4 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0X713 | 6-83 | 78 | PQEIWEAALGEIQVQVSQPNYRTWFGKTTGLSYQENQFVVGVPNAFISEYLDQNQRSLIKKALICLTSPDIQVVFQVN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8CH71-F1 | 4-76 | 96.05 | 85.76 | View in AlphaFoldDB ↗ |