DPCfam | MC80963
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Residues in low-complexity regions (%) | 26.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12569 |
| Sequences matching dominant architecture (%) | 97.78 |
| Average overlap percent | 36.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A091SIP7 | 2-102 | 101 | NLSAKELKKMLSKQRRAQKKAKLEEERKHAERERLQKNQKKKRDEEEEETSGPREELVPEKLERVENPLEEAIKFLIPLKNLIGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VWI2-F1 | 589-691 | 100.00 | 76.64 | View in AlphaFoldDB ↗ |