DPCfam | MC80853
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 376 ± 58 aa |
| Residues in low-complexity regions (%) | 18.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 77.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05110- PF18875 |
| Sequences matching dominant architecture (%) | 72.88 |
| Average overlap percent | 60.61 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0XW70 | 1-432 | 432 | SNEVHCAEEILKDSQHLSSTTKNQKQYDTSSKTHLNSQQGTAMLEDNTQLSDNEDSDSEQTPEKPPSSSAPPSTPQLLPDPLASA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P51827-F1 | 469-861 | 99.72 | 40.31 | View in AlphaFoldDB ↗ |