DPCfam | MC80724
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 304 ± 42 aa |
| Residues in low-complexity regions (%) | 8.35 |
| Residues in coiled-coil regions (%) | 9.29 |
| Predicted disordered residues (%) | 23.7 |
| Average transmembrane regions | 1.7 |
| Dominant Pfam architecture(s) | PF10112 |
| Sequences matching dominant architecture (%) | 92.48 |
| Average overlap percent | 57.51 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W6WE84 | 116-450 | 335 | PDNCPPNGQRPPQQPIRPSYSSPNLHNSRIPGAISGMTWAIAGLVMGVPLLIADIAMVAAAATGMVAFSEFMVAGAVTFSMTAAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P7R1-F1 | 81-211 | 41.03 | 93.99 | View in AlphaFoldDB ↗ |