DPCfam | MC80334
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 149 ± 21 aa |
| Residues in low-complexity regions (%) | 1.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7VSP3 | 180-342 | 163 | KPRKFFTKGRIFKTVWFEPFGEFSGSSRARPSELAYHESCPDYSGTGEKPYGRYRWFVVIRKQQQHSLCFAIVNGGVKSMAKNRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W304-F1 | 425-574 | 95.48 | 87.18 | View in AlphaFoldDB ↗ |