DPCfam | MC80243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 256 ± 41 aa |
| Residues in low-complexity regions (%) | 9.19 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 10.09 |
| Average transmembrane regions | 4.81 |
| Dominant Pfam architecture(s) | PF01381 |
| Sequences matching dominant architecture (%) | 9.85 |
| Average overlap percent | 4.04 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009EF128E | 112-363 | 252 | SDTNVLAASESSDVRKVSLEEASEYTNLVAQSSSAMALGVALCTWSPIVLFVLEALSEKNFMGMSEGTATGIGLAVLLLAVAVAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P3W4-F1 | 1-242 | 80.07 | 82.19 | View in AlphaFoldDB ↗ |