DPCfam | MC80206
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 699 ± 112 aa |
| Residues in low-complexity regions (%) | 5.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.48 |
| Average transmembrane regions | 4.38 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5N6K7 | 236-1042 | 806 | YDEHFKECVQDDMIALGSLSLEQEAWSVKQKRLMLGKEQGRGKRLMSFLRGNKKVANCIQNGEITFAVLKIAKQLLLCFRAESQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M0RD45-F1 | 65-708 | 98.96 | 71.14 | View in AlphaFoldDB ↗ |