DPCfam | MC79902
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 218 ± 23 aa |
| Residues in low-complexity regions (%) | 20.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.98 |
| Average transmembrane regions | 5.47 |
| Dominant Pfam architecture(s) | PF11139 |
| Sequences matching dominant architecture (%) | 99.62 |
| Average overlap percent | 96.27 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1CWN0 | 4-220 | 217 | VLGSILPLSMGVALGPFPIIMIVLLLGSARPNANGLAFLSGWVVGLAAIVAVLTFALDALDGAGNDPGPMAGVVRIILGSALLVM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3L890-F1 | 1-269 | 100.00 | 67.39 | View in AlphaFoldDB ↗ |