DPCfam | MC79859
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 65 ± 2 aa |
| Residues in low-complexity regions (%) | 3.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02384 |
| Sequences matching dominant architecture (%) | 79.17 |
| Average overlap percent | 14.34 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2YLD1 | 301-365 | 65 | LKVDDDVLKKIIRDLYYPCPYEFSIMPAEILGQVYEQFLGKVIRLTASHQAKVEEKPEVKKAGGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P25239-F1 | 297-351 | 84.38 | 85.92 | View in AlphaFoldDB ↗ |