DPCfam | MC7973
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Residues in low-complexity regions (%) | 3.03 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 23.3 |
| Average transmembrane regions | 0.9 |
| Dominant Pfam architecture(s) | PF06212 |
| Sequences matching dominant architecture (%) | 96.3 |
| Average overlap percent | 90.49 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00073D8613 | 8-125 | 118 | FTQDLPPKEGYSRIQTERIPLRTVLGGRKVLGISLFCTVIGHYVYYTQWKRIKRESVEMRSAQFAILPFLIAERDRGLLKQVKRN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95KV7-F1 | 6-119 | 100.00 | 95.54 | View in AlphaFoldDB ↗ |