DPCfam | MC79669
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 770 ± 97 aa |
| Residues in low-complexity regions (%) | 2.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.64 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01979 |
| Sequences matching dominant architecture (%) | 55.8 |
| Average overlap percent | 15.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060SIW2 | 5-630 | 626 | WAVRDAYNKACKIKASQDEYCIKALAGDWESIKNEKFPESYQWESLVEILRGRVKSKVQTHCYEALDIDNFVRISNEFQFPVAAF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q3U5-F1 | 165-997 | 99.49 | 93.84 | View in AlphaFoldDB ↗ |