DPCfam | MC79571
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 66 ± 10 aa |
| Residues in low-complexity regions (%) | 0.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12763 |
| Sequences matching dominant architecture (%) | 0.63 |
| Average overlap percent | 12.5 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077A84B1 | 264-364 | 101 | ETYSWTWDGPGLSLLAVLVLCQLSNDAEIEFLPVWNPSEEEREDPKLYAENVRQHMARCLNLPVTGHSFEDAVLMSKAVELGLPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NF37-F1 | 256-324 | 97.22 | 91.06 | View in AlphaFoldDB ↗ |