DPCfam | MC79467
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Residues in low-complexity regions (%) | 4.33 |
| Residues in coiled-coil regions (%) | 0.61 |
| Predicted disordered residues (%) | 7.87 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q1EG33 | 1089-1189 | 100 | LLHIIKRTFRYMHSLVAKRMHEAELQYDVRPVLKLRRKETMWLGLSAYLRVLQKKQSRYSELLASLREEIGRCGHLDRHNDALRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0G7E0-F1 | 1160-1257 | 98.99 | 91.23 | View in AlphaFoldDB ↗ |