DPCfam | MC79084
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 377 ± 57 aa |
| Residues in low-complexity regions (%) | 3.55 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 11.61 |
| Average transmembrane regions | 2.57 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M9ES40 | 27-366 | 340 | QGFFEVTLGWGKLGFTAAKLIDVTWDLVIGRGGQAIMSLCAWRVFSEYLETSLATKPATYTTVWLLRFHRDSSVLSSLRLFFQFF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1C828-F1 | 131-558 | 99.74 | 86.18 | View in AlphaFoldDB ↗ |