DPCfam | MC79071
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 217 ± 37 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01446 |
| Sequences matching dominant architecture (%) | 85.67 |
| Average overlap percent | 79.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H5QCN3 | 41-334 | 294 | LARAYDIVDRRKAARLRECATILIMEEWADGSKRLAAMSSCRVRLCPVCSWRRALKTYANTLQCAQWVQREQRGVHWLMLTLTVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P36229-F1 | 27-267 | 99.05 | 85.72 | View in AlphaFoldDB ↗ |