DPCfam | MC79067
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Residues in low-complexity regions (%) | 0.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146MF30 | 990-1051 | 62 | WTAVDPKTTVPFSFHERGKVRHRDSHKLRSHQLGVRVEGWQPIIPVTVDRVGVYFRQAFPEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4U329-F1 | 793-855 | 91.55 | 76.03 | View in AlphaFoldDB ↗ |